DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and Sidpn

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster


Alignment Length:393 Identity:103/393 - (26%)
Similarity:163/393 - (41%) Gaps:101/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SSKEQISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLV------PSAYEKQGSA---K 138
            ||.:.::     |.|.:|::..:.::||:||.|||.||..||.|:      .:|...:|.|   |
  Fly    38 SSTQNVT-----SSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTK 97

  Fly   139 LEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEG------MD 197
            ||||:||:|||.|.:  :.:.||    ||   .::.:..|:.:||.||||||.|.|.      ..
  Fly    98 LEKADILELTVRHFQ--RHRNLD----DP---TVNKYRAGYTDCAREVARYLATPEPPPMGTMPT 153

  Fly   198 IQDP-LRLRLMSHLQYFVQQRELSAKSCA-SPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGA 260
            :.:| .:.||:.||...:  .|:..:.|. |...::.:..|||.:..|        :...:.|..
  Fly   154 LAEPGSKARLLRHLDQCI--AEIDVEICPHSTAAFAESPSSSSCFDLN--------HGKKSQPEE 208

  Fly   261 YVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQQQQQQQQQQQQQHQ 325
            :...|.:..::|...::.|....:..||        ||......|.::.:..|.|.|.....|  
  Fly   209 HSLDYSSQDSNPVDYSKGLKMVAAEQRT--------LPVTPAPQDENNNRGLQAQAQTPIPIQ-- 263

  Fly   326 QQQHQQQQQRTQTTPQ-----PTQQQHYTHDHSAV--------------HSEQQ----------V 361
                .|.|.:.||:|.     |::.. |..|.:.|              |.:||          .
  Fly   264 ----VQSQTQGQTSPHVDAVAPSELS-YEEDRNKVCANVLEQYKQQLKAHVQQQPESANGVLVLP 323

  Fly   362 PTYIELTNSNRPAAIGSDSLSYSAAPQY-PVSGLPGQDYNNSSVLQYATPNGA---KPYRPWGAE 422
            |.|::|.     ||:|     .||.|.. |::  ...|:.....||...|:.|   .|..|.|.|
  Fly   324 PHYVQLA-----AALG-----LSAQPLVDPIA--TRTDFERLIELQRVQPHLAGKLSPSFPGGLE 376

  Fly   423 MAY 425
            .|:
  Fly   377 AAH 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 27/64 (42%)
ORANGE 172..218 CDD:128787 16/52 (31%)
SidpnNP_523599.1 HLH 48..117 CDD:238036 27/70 (39%)
Hairy_orange 125..172 CDD:284859 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.