DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HES1

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:366 Identity:91/366 - (24%)
Similarity:139/366 - (37%) Gaps:114/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DLYSEESSKE--------QISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEK 133
            |:..:.||..        ..:|.:|.:.. ..||..:.::||:||.|||.||::||.|:..|.:|
Human     4 DIMEKNSSSPVAATPASVNTTPDKPKTAS-EHRKSSKPIMEKRRRARINESLSQLKTLILDALKK 67

  Fly   134 QGS--AKLEKAEILQLTVEHLKSLQ-SKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEG 195
            ..|  :|||||:||::||:||::|| ::...:||.||.  .:..:..||.||..||.|:|.|.||
Human    68 DSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPS--VLGKYRAGFSECMNEVTRFLSTCEG 130

  Fly   196 MDIQDPLRLRLMSHLQYFVQQ-----------RELSAKSCASPGGWSPAAPSSSGYQPNCAAAPY 249
            ::.:  :|.||:.||...:.|           ..|.|.....||   |..|..:.:.|.....|.
Human   131 VNTE--VRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPG---PGGPQHAPFAPPPPLVPI 190

  Fly   250 QSYAAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQQQQ 314
            ...|||...||...    |.:...:.|:..||                                 
Human   191 PGGAAPPPGGAPCK----LGSQAGEAAKVFGG--------------------------------- 218

  Fly   315 QQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTHDHSA-VHSEQQVPTYIELTNSNRPAAIGS 378
                                 .|..|.|..|..:...:.| .||...:|.|    .||...::|.
Human   219 ---------------------FQVVPAPDGQFAFLIPNGAFAHSGPVIPVY----TSNSGTSVGP 258

  Fly   379 DSLSYSAAPQYPVSGLPGQDYNNSSVLQYATPNGAKPYRPW 419
            :::|.|:.|......:                     :|||
Human   259 NAVSPSSGPSLTADSM---------------------WRPW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 28/57 (49%)
ORANGE 172..218 CDD:128787 17/56 (30%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 7/40 (18%)
bHLH-O_HES1_4 33..95 CDD:381465 30/61 (49%)
Hairy_orange 110..148 CDD:400076 16/39 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 7/46 (15%)
WRPW motif 275..278 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.