Sequence 1: | NP_523657.1 | Gene: | Hey / 35764 | FlyBaseID: | FBgn0027788 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955918.3 | Gene: | her8a / 323656 | ZFINID: | ZDB-GENE-030131-2376 | Length: | 221 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 66/196 - (33%) |
---|---|---|---|
Similarity: | 96/196 - (48%) | Gaps: | 33/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSY 165
Fly 166 DP-------QRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQ--QRELSA 221
Fly 222 KSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLS-----------ASPSQQ 275
Fly 276 A 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hey | NP_523657.1 | HLH | 100..156 | CDD:238036 | 29/54 (54%) |
ORANGE | 172..218 | CDD:128787 | 13/47 (28%) | ||
her8a | NP_955918.3 | HLH | 17..75 | CDD:238036 | 30/55 (55%) |
Hairy_orange | 95..133 | CDD:284859 | 13/44 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |