DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and her8a

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:196 Identity:66/196 - (33%)
Similarity:96/196 - (48%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSY 165
            ||.|:.:||||||:||||||.:||.::..||....| |||||::|::||:|:::||.......|.
Zfish    20 RKLRKPLIEKKRRERINSSLEQLKGIMVDAYNLDQS-KLEKADVLEITVQHMENLQRGHGQGGSN 83

  Fly   166 DP-------QRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQ--QRELSA 221
            .|       ||.:.     |:.:|..||...|::..|||  ..|..||::||...:.  ..|.|.
Zfish    84 SPGTGFESRQRYSS-----GYIQCMHEVHNLLLSCPGMD--KTLGARLLNHLLKSLPHISTEPSG 141

  Fly   222 KSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLS-----------ASPSQQ 275
            .|.|......|.:|:.|......:..|:....:|:.|     |.||.|           :|||.|
Zfish   142 TSSAGTSSPLPLSPTQSPINLPSSLQPHALLLSPSPP-----SSPTHSLVRPREQSSPPSSPSPQ 201

  Fly   276 A 276
            :
Zfish   202 S 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 29/54 (54%)
ORANGE 172..218 CDD:128787 13/47 (28%)
her8aNP_955918.3 HLH 17..75 CDD:238036 30/55 (55%)
Hairy_orange 95..133 CDD:284859 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.