DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and her6

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:233 Identity:74/233 - (31%)
Similarity:115/233 - (49%) Gaps:34/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DLYSEESSKE--------QISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEK 133
            |:..:.||..        ..:|.:|.:.. ..||..:.::||:||.|||.||.:||.|:..|.:|
Zfish     4 DIMEKNSSSPVAATPASMNTTPDKPKTAS-EHRKSSKPIMEKRRRARINESLGQLKTLILDALKK 67

  Fly   134 QGS--AKLEKAEILQLTVEHLKSLQ-SKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEG 195
            ..|  :|||||:||::||:||:::| ::...:|:.||  ..:..:..||.||..||.|:|.|.||
Zfish    68 DSSRHSKLEKADILEMTVKHLRNMQRAQMTAALNTDP--TVLGKYRAGFSECMNEVTRFLSTCEG 130

  Fly   196 MDIQDPLRLRLMSHLQYFVQQRELSAKSCAS----PGGWSPAAPSSSGYQPNCAAAPYQSYAAPA 256
            ::.:  :|.||:.||...:.|  ::|.:..:    |.|  |..||.|.......:|..|:...| 
Zfish   131 VNTE--VRTRLLGHLASCMTQ--INAMNYPTQHQIPAG--PPHPSFSQPMVQIPSATQQANVVP- 188

  Fly   257 NPGAYVSSYPTLSAS----PSQQAQQLGGRTSVSRTSG 290
                 :|..|..|.|    .|...:..||...|..|.|
Zfish   189 -----LSGVPCKSGSSSNLTSDATKVYGGFQLVPATDG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 28/57 (49%)
ORANGE 172..218 CDD:128787 17/45 (38%)
her6NP_571154.2 HLH 32..95 CDD:238036 29/63 (46%)
Hairy_orange 110..148 CDD:284859 16/39 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.