DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and Hes2

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus


Alignment Length:171 Identity:53/171 - (30%)
Similarity:82/171 - (47%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTVEHLKSLQSKTLDSL 163
            ||..:.::||:||.|||.||::||.||......:.|  :|||||:||::||..|:.         
  Rat    14 RKSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLRE--------- 69

  Fly   164 SYDPQRV-------AMDYHIIGFRECAAEVARYLVTIEGMDIQDP-LRLRLMSHLQYFVQQRELS 220
              .|..|       ::|.::.|:|.|.|.:||.|   ....:.:| :..||:.||    :||.:|
  Rat    70 --QPASVCSTEAPGSLDSYLEGYRACLARLARVL---PACSVLEPAVSARLLEHL----RQRTVS 125

  Fly   221 AKSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAY 261
                ..|...:||:.|        |.||......|::.|.:
  Rat   126 ----GGPPSLTPASAS--------APAPSPPVPPPSSLGLW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 26/56 (46%)
ORANGE 172..218 CDD:128787 14/46 (30%)
Hes2NP_062109.1 HLH 12..69 CDD:238036 26/54 (48%)
ORANGE 84..128 CDD:128787 16/54 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 10/43 (23%)
WRPW motif 154..157 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.