DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and Hes7

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_038941367.1 Gene:Hes7 / 287423 RGDID:1305914 Length:358 Species:Rattus norvegicus


Alignment Length:255 Identity:68/255 - (26%)
Similarity:92/255 - (36%) Gaps:80/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQG--SAKLEKAEILQLTVEHLKSLQ 156
            |||......|  .::||:||||||.||.||:.|:......|.  :.||||||||:..|.:|:. :
  Rat    37 GSCFWFEMLK--PLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRE-R 98

  Fly   157 SKTLDSLSYDPQRVAMDYHIIG-FRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQREL- 219
            |:.      :|...|..   :| .||.....||.....||..          |.:...|.:|.. 
  Rat    99 SRV------EPPGTARG---VGQRREAGGWGARNARAGEGAG----------SEVDRGVGERPAV 144

  Fly   220 ------SAKSCAS-------PGGWSPA----------------APSSSGYQPNCAAAPYQSYAAP 255
                  :.::|.|       |....||                |||.:...|    .|......|
  Rat   145 LPDEVNNTRACLSLCLPRCPPLHVHPASCLCLCARLTSVSLRPAPSLNPVGP----LPRPPVLPP 205

  Fly   256 ANPGAYVSSYPTLSASPSQQAQQL------GGRTSVSRTSGSAVTESLPSHDLHSDSSSQ 309
            |.||        :..||.|.|:.|      |.|..:.|.:..|       ||....:.||
  Rat   206 AAPG--------VPRSPGQDAEALASCYLSGFRECLLRLAAFA-------HDASPAARSQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 25/57 (44%)
ORANGE 172..218 CDD:128787 9/46 (20%)
Hes7XP_038941367.1 bHLH-O_HES7 44..102 CDD:381468 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.