DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HEYL

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens


Alignment Length:385 Identity:125/385 - (32%)
Similarity:173/385 - (44%) Gaps:90/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LKRTLSESDCD-------DLYSEESSKEQISP-SEPGSCQLMSRKKRRGVIEKKRRDRINSSLTE 122
            :||....|..|       |:..|....:...| |.|.|.|:.:|||.||:|||:|||||||||:|
Human     1 MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSE 65

  Fly   123 LKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVA 187
            |:||||:|:|||||:||||||:||:||:|||.|.: |..:..:|.:.:|:|:..||||||..||.
Human    66 LRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHA-TGGTGFFDARALAVDFRSIGFRECLTEVI 129

  Fly   188 RYLVTIEGMDIQ-DPLRLRLMSHLQYFVQQRELSAKSCASPGG--------WS-----PAAPSSS 238
            |||..:||...: ||:|:||:|||..:..:.|.|    .:|.|        ||     |..|:.|
Human   130 RYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPS----PTPTGPLAFPAWPWSFFHSCPGLPALS 190

  Fly   239 GYQPNCAAAPYQSYAAPANPGAYVSSY--PTLSASPSQQAQQ--LGGRTSVSRTSGSAVTESLPS 299
            .........|     :|..||....:|  |.|..:|.::|..  |..|.:|..:.|::.|     
Human   191 NQLAILGRVP-----SPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSRGASST----- 245

  Fly   300 HDLHSDSSSQQQQQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTHDHSAVHSEQQVPTY 364
                                              :|.:...:|...........|..|....|  
Human   246 ----------------------------------RRARPLERPATPVPVAPSSRAARSSHIAP-- 274

  Fly   365 IELTNSNRPAAIG-SDSLSYSAAPQYPVSGLPGQDYNNSSVLQYATPNGAKPYRPWGAEM 423
              |..|:.|...| :.|.:|.|.|. |.|..||         ....|.||..|..|.:|:
Human   275 --LLQSSSPTPPGPTGSAAYVAVPT-PNSSSPG---------PAGRPAGAMLYHSWVSEI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 42/55 (76%)
ORANGE 172..218 CDD:128787 22/46 (48%)
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 20/55 (36%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 45/69 (65%)
HLH 42..100 CDD:238036 43/57 (75%)
ORANGE 115..162 CDD:128787 22/46 (48%)
Atrophin-1 <136..311 CDD:331285 51/236 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308 19/121 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7334
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201152at2759
OrthoFinder 1 1.000 - - FOG0002229
OrthoInspector 1 1.000 - - otm40692
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1473
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.