DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HEY2

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens


Alignment Length:383 Identity:139/383 - (36%)
Similarity:185/383 - (48%) Gaps:80/383 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KRTLSESDCDDL--------YSEESSKEQISPSEP-GSCQLMSRKKRRGVIEKKRRDRINSSLTE 122
            :.|.||||.|:.        ||.:|:...|..:.| .:.|:|:||||||:|||:||||||:||:|
Human     6 EETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSE 70

  Fly   123 LKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVA 187
            |:||||:|:|||||||||||||||:||:|||.||: |.....:|...:|||:..||||||..|||
Human    71 LRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQA-TGGKGYFDAHALAMDFMSIGFRECLTEVA 134

  Fly   188 RYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSCASPGGWSPAAPSSSGYQPNCAAAPYQSY 252
            |||.::||:|..||||:||:|||.....|||.:|.:.:......|..|.      :.|||.:...
Human   135 RYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPH------HWAAAFHHLP 193

  Fly   253 AAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQQQQQQQ 317
            ||...|..       |.||.|... :|...:.|....|||:   |.:...|:||:          
Human   194 AALLQPNG-------LHASESTPC-RLSTTSEVPPAHGSAL---LTATFAHADSA---------- 237

  Fly   318 QQQQQQHQQQQHQQQQQRTQTTPQ-----PTQQQHYTHDHSAVHSEQQVPTYIELTNSNRPAAIG 377
                            .|..:|..     |..........:.||:.....|          ||..
Human   238 ----------------LRMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAAT----------AAAH 276

  Fly   378 SDSLSYSAA-PQYPVSGL-----------PGQDYNNSSVLQYATPNGAKPYRPWGAEM 423
            |..||::.| |..|.:..           |......||..|.::....|||||||.|:
Human   277 SFPLSFAGAFPMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 44/55 (80%)
ORANGE 172..218 CDD:128787 27/45 (60%)
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 15/45 (33%)
bHLH-O_HEY2 40..121 CDD:381490 53/81 (65%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116 49/69 (71%)
ORANGE 119..165 CDD:128787 27/45 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337 11/28 (39%)
YRPW motif 327..330 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7334
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201152at2759
OrthoFinder 1 1.000 - - FOG0002229
OrthoInspector 1 1.000 - - otm40692
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1473
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.