DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HEY1

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:404 Identity:134/404 - (33%)
Similarity:180/404 - (44%) Gaps:129/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AHSNHSHGHSQGHSHGIGSLKRTL--SESDCDDLYSEESSKEQISPSEPGSCQLMSRKKRRGVIE 109
            ||..:|...|:        |..|:  .:...|:..:..|:...:||:.  |.|:::||:|||:||
Human     4 AHPEYSSSDSE--------LDETIEVEKESADENGNLSSALGSMSPTT--SSQILARKRRRGIIE 58

  Fly   110 KKRRDRINSSLTELKRLVPSAYEK----QGSAKLEKAEILQLTVEHLKSLQSKTLDSLSY-DPQR 169
            |:||||||:||:||:||||||:||    |||||||||||||:||:|||.|.  |.....| |...
Human    59 KRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLH--TAGGKGYFDAHA 121

  Fly   170 VAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSCASPG--GWSP 232
            :||||..:|||||.|||||||..|||:|..||||:||:|||..:..|||.::.:.|..|  .|. 
Human   122 LAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWG- 185

  Fly   233 AAPSSSGYQPNCA---AAPYQSY------AAPANP---GAYVSSYPTLSASPSQQAQQLGGRTSV 285
               :..|:.|:.|   ..|...:      |:|..|   |...|::|...|..:..:..||....|
Human   186 ---TVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPV 247

  Fly   286 SRTSGSAVTESLPSHDLHSDSSSQQQQQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTH 350
            . ||.|.::..|    |.|.:|.                                          
Human   248 V-TSASKLSPPL----LSSVASL------------------------------------------ 265

  Fly   351 DHSAVHSEQQVPTYIELTNSNRPAAIGS------DSLSYSAAPQYPVSGLPGQDYNNSSVLQYAT 409
                               |..|.:.||      ::||.||..|                    .
Human   266 -------------------SAFPFSFGSFHLLSPNALSPSAPTQ--------------------A 291

  Fly   410 PNGAKPYRPWGAEM 423
            .|..|||||||.|:
Human   292 ANLGKPYRPWGTEI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 44/59 (75%)
ORANGE 172..218 CDD:128787 29/45 (64%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 13/57 (23%)
bHLH_SF 41..126 CDD:381792 53/88 (60%)
ORANGE 124..170 CDD:128787 29/45 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 8/37 (22%)
YRPW motif 298..301 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7334
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201152at2759
OrthoFinder 1 1.000 - - FOG0002229
OrthoInspector 1 1.000 - - otm40692
orthoMCL 1 0.900 - - OOG6_108077
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1473
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.