DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and her9

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_571948.1 Gene:her9 / 140613 ZFINID:ZDB-GENE-011213-1 Length:291 Species:Danio rerio


Alignment Length:346 Identity:95/346 - (27%)
Similarity:144/346 - (41%) Gaps:93/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTVEH 151
            :|.:|.:.. ..||..:.::||:||.|||.||.:||.|:..|.:|..|  :|||||:||::||:|
Zfish    24 TPDKPKNAS-EHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKH 87

  Fly   152 LKSLQSKTLD-SLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQ 215
            |::||...:. :||.|..  .:..:..||.||..||.|:|.|.||::.:  :|.||::||...:.
Zfish    88 LRNLQRVQMSAALSADTN--VLSKYRAGFNECMNEVTRFLSTCEGVNTE--VRSRLLNHLSGCMG 148

  Fly   216 QRELSAKSCASPGGWSPAAPSSSGY--QPNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQAQQ 278
            |  :.|.:...|      ||:...:  ||.....|   ...|.| ||.:.|  .||.|.:...:.
Zfish   149 Q--MMAMNYPQP------APAQQAHLAQPLHVQLP---STLPIN-GASMGS--KLSPSEAVSPKV 199

  Fly   279 LGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQQQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPT 343
            .||...|..|.|. ....:|:....|                                .|||   
Zfish   200 FGGFQLVPATDGQ-FAFLIPNPAFAS--------------------------------ATTP--- 228

  Fly   344 QQQHYTHDHSAVHSEQQVPTYIELTNSNRPAAIGSDSLSYSAAPQY--PVSGLPGQDYNNSSVLQ 406
                            .:|.|   .|::.|..:.:..:..|:||..  ||.|:.    :.|.|.|
Zfish   229 ----------------VIPLY---ANASVPVTVNASPVQASSAPTVASPVQGMT----SFSGVPQ 270

  Fly   407 YATPNGAKP--------YRPW 419
            ..:|.|...        :|||
Zfish   271 AVSPVGVSAGAESNEPVWRPW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 28/57 (49%)
ORANGE 172..218 CDD:128787 17/45 (38%)
her9NP_571948.1 HLH 32..93 CDD:238036 29/61 (48%)
Hairy_orange 110..147 CDD:284859 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.