DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and hes7.2

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_002942675.1 Gene:hes7.2 / 100496131 XenbaseID:XB-GENE-486482 Length:243 Species:Xenopus tropicalis


Alignment Length:287 Identity:70/287 - (24%)
Similarity:113/287 - (39%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ISPSEPGSCQLMS-------RKKRRGVIEKKRRDRINSSLTELKRLVPSAY--EKQGSAKLEKAE 143
            |.|...| |::.:       ::..:.||||:||||||.||..|:.|:..|.  |...:.|.|||:
 Frog     6 ICPQAAG-CRMRNSYPNREDKRLMKPVIEKRRRDRINQSLEHLRTLLLEATHDETLKNPKAEKAD 69

  Fly   144 ILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGM--DIQDPLRLRL 206
            ||:.||..||...    :.:..|.:::...:. .||||...:...:|.:.:.:  ..::.:..||
 Frog    70 ILKKTVHFLKMCH----NPVPSDGKKLLSGFK-GGFREGLNQATSFLNSADSICQKKKEYVVQRL 129

  Fly   207 MSHLQYFVQQRELSAKSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLSAS 271
            ..|::   ||.:   |.|....                     |..::..|              
 Frog   130 CQHME---QQTQ---KHCHDSA---------------------QDVSSRVN-------------- 153

  Fly   272 PSQQAQQLGGRTSVSRTSGSAVTE------SLPSHDLHSDSSSQQQQQQQQQQQQQQQHQQQQHQ 330
               |.|.|.....:||.:|:.:.:      |.|.|..|...||..:.....|:|||...|..|  
 Frog   154 ---QRQILPSPPLISRVTGNGLEQSPETQTSRPPHSHHPSPSSSFRTPCMGQEQQQTPPQTFQ-- 213

  Fly   331 QQQQRTQTTPQPTQQQHYTHDHSAVHS 357
                 ..|..:|||:..:....|:|:|
 Frog   214 -----ANTNKKPTQRTLFPPTSSSVNS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 26/64 (41%)
ORANGE 172..218 CDD:128787 10/47 (21%)
hes7.2XP_002942675.1 HLH 22..80 CDD:238036 25/57 (44%)
ORANGE 94..138 CDD:128787 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.