DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and hey2

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_002936042.2 Gene:hey2 / 100485328 XenbaseID:XB-GENE-485923 Length:394 Species:Xenopus tropicalis


Alignment Length:398 Identity:139/398 - (34%)
Similarity:184/398 - (46%) Gaps:104/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SLKR----TLSESDCDDL--------YSEESSKEQISPSEP-GSCQLMSRKKRRGVIEKKRRDRI 116
            ::||    |.|:||.|:.        ||..||...|..:.| .:.|:|:||||||:|||:|||||
 Frog    59 AMKRPCDDTSSDSDIDETIDVGSENNYSGHSSGSLIRSNSPTTTSQIMARKKRRGIIEKRRRDRI 123

  Fly   117 NSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRE 181
            |:||:||:||||:|:|||||||||||||||:||:|||.||: |.....:|...:|||:..|||||
 Frog   124 NNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQA-TGGKGYFDAHALAMDFMSIGFRE 187

  Fly   182 CAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSCASPGGWSPAAPSSSGYQPNCAA 246
            |..||||||.::||:|..||||:||:|||.....|||..|.:       |..||......|:..|
 Frog   188 CLTEVARYLGSVEGLDSSDPLRVRLVSHLSSCASQREAVAMT-------STVAPHQHSLHPHHWA 245

  Fly   247 APYQSYAAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQ 311
            |.:...                   |:...||.|..:|.:.|...:....|||            
 Frog   246 AAFHHL-------------------PAALLQQNGLSSSDNMTCRLSTATELPS------------ 279

  Fly   312 QQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTHDHSA--VHSEQQVPTYI-ELTNS--- 370
                            || .....|.|         :.|..:|  |.:...||..: .|:.|   
 Frog   280 ----------------QH-GSALLTAT---------FAHADAALRVPAAGSVPPGVPPLSTSLLS 318

  Fly   371 -----NRPAAIGSDSLSYSAAPQYPV--SGLPGQDYNNSSVLQYATP-------------NGAKP 415
                 :..||..:.|...|.|..:||  .|........|:....|:|             ..:||
 Frog   319 LSATVHAAAAAAAQSFPLSFAGAFPVLPPGAAAAAMAASAATAIASPLSLTSSPRQAGGNVSSKP 383

  Fly   416 YRPWGAEM 423
            |||||.|:
 Frog   384 YRPWGTEV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 44/55 (80%)
ORANGE 172..218 CDD:128787 27/45 (60%)
hey2XP_002936042.2 bHLH-O_HEY2 99..180 CDD:381490 53/81 (65%)
Hairy_orange 182..221 CDD:369405 24/38 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3738
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201152at2759
OrthoFinder 1 1.000 - - FOG0002229
OrthoInspector 1 1.000 - - otm47871
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1473
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.