DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and hes2

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:193 Identity:54/193 - (27%)
Similarity:83/193 - (43%) Gaps:38/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YSEESSKEQISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEK 141
            |..::.|.....||       .||..:.::||:||.|||.||.:||.|:.....|..|  :||||
 Frog    14 YQPKTGKRNQEASE-------LRKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEK 71

  Fly   142 AEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVA-----RYLVTIEGMDIQDP 201
            |:||::||..|:.:...        |.:...|.:..|:|.|...::     .:::|.|..:    
 Frog    72 ADILEMTVRFLRDIPPV--------PAQNPADRYKEGYRACVERLSAILNKSHVLTGEASN---- 124

  Fly   202 LRLRLMSHLQYFVQQRELSAKSC-ASPGGWSP-----AAPSSSGYQPNCAAAPYQSYAAPANP 258
               ||::|||   :..||....| ..|...||     .:|.:|..:......|.....||..|
 Frog   125 ---RLLNHLQ---RSPELCCSDCHHPPKSHSPRIVLHVSPRTSQLESPLLNQPSSHRPAPCPP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 26/57 (46%)
ORANGE 172..218 CDD:128787 11/50 (22%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 28/78 (36%)
Hairy_orange 97..133 CDD:369405 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.