DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and SLC25A27

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:319 Identity:90/319 - (28%)
Similarity:149/319 - (46%) Gaps:38/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDSSRRLP---RW------WFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILK------ 52
            |:..|.||   ||      ...|..|.:|...|.|:||.|.:||.|.:|....:|:..:      
Human     5 EEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYR 69

  Fly    53 -------GIHERSGILGFYNGISASWFRQLTYTTTRFALYE------AGKDYVDTQKVSSKMALA 104
                   ||.|..|.|..:.|::.:.:|.:.|:..|...||      .||...:...:...:...
Human    70 GMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGG 134

  Fly   105 TFAGIVGGIVGVPGDVVTVRLQNDVKLP-EEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSR 168
            ..||::|..:..|.|:|.|::|.:.|.. |.|...::.|.....:|..|.|:..|:.|.||.:.|
Human   135 MMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQR 199

  Fly   169 AVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEF 233
            |.|:.:|....||.||..|.:.|...:.:..|..:|..:|.:|.::..|.||||:..|| ||.:.
Human   200 AALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMN-QPRDK 263

  Fly   234 SGIGGAFLSTAK--------QGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFGYLP 284
            .|.|..:.|:..        :|.::.||||:|:.:|::|.:::.::.||:.|...|..|
Human   264 QGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 80/287 (28%)
Mito_carr 15..91 CDD:278578 26/94 (28%)
Mito_carr 93..187 CDD:278578 27/94 (29%)
Mito_carr 200..281 CDD:278578 27/88 (31%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 24/97 (25%)
Solcar 1 21..115 24/93 (26%)
Mito_carr 125..219 CDD:365909 27/93 (29%)
Solcar 2 125..217 27/91 (30%)
Solcar 3 226..317 27/91 (30%)
Mito_carr 227..317 CDD:365909 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.