DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and SLC25A14

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001269126.1 Gene:SLC25A14 / 9016 HGNCID:10984 Length:353 Species:Homo sapiens


Alignment Length:318 Identity:83/318 - (26%)
Similarity:135/318 - (42%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI--------LKGIHERSGILGFYNGISAS 70
            :||:.:.:|..||.|:||.|.:||.|.|:......||        |..|.:..|:|..|:||:.:
Human    43 YGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPA 107

  Fly    71 WFRQLTYTTTRFALYEAGK----DYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKL 131
            ..||.:|.|.:..:|::.|    :.::.:.:...|.....:|::...:..|.||:.:|:|....|
Human   108 LLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSL 172

  Fly   132 PEEKRRNYKHVFDG-----LFRIYKEEGVSSLFR------------------------------- 160
                       |.|     ...||::||...|:|                               
Human   173 -----------FQGSMIGSFIDIYQQEGTRGLWRCLCSKAVTGCVLWLMPVIPALWEANAGGSLE 226

  Fly   161 GTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTF 225
            |.||...||.::.......||..|:.|.::...|:.:..||.:|...|....:.:.|:||::|..
Human   227 GVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRM 291

  Fly   226 MN--AQPGE---FSG-IGGAFLSTAKQGPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
            ||  |..|.   :.| :.|.......:|..|.||||.|..:|:.|..||.|:.|||.:
Human   292 MNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 81/313 (26%)
Mito_carr 15..91 CDD:278578 28/87 (32%)
Mito_carr 93..187 CDD:278578 24/129 (19%)
Mito_carr 200..281 CDD:278578 29/84 (35%)
SLC25A14NP_001269126.1 Mito_carr 37..133 CDD:278578 28/89 (31%)
PTZ00169 41..351 CDD:240302 83/318 (26%)
Mito_carr 134..254 CDD:278578 24/130 (18%)
Mito_carr 262..351 CDD:278578 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.