DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a14

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:291 Identity:85/291 - (29%)
Similarity:135/291 - (46%) Gaps:42/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI--------LKGIHERSGILGFYNGISAS 70
            :||:.:.:|..||.|:||.|.:||.|.|:......||        |..|:...|||..|:||:.:
  Rat    65 YGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYREEGILALYSGIAPA 129

  Fly    71 WFRQLTYTTTRFALYEAGK----DYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKL 131
            ..||.:|.|.:..:|::.|    :.::.:.:...|.....:|::...:..|.||:.:|:|....|
  Rat   130 LLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSL 194

  Fly   132 PEEKRRNYKHVFDG-----LFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIAT 191
                       |.|     ...||::||...|:||.||...||.::.......||..|:.|.::.
  Rat   195 -----------FQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSG 248

  Fly   192 GAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQ---------PGEFSGIGGAFLSTAK-Q 246
            ..|:.:..||.:|...|....:.:.|:||::|..||.:         .|...||    |...| :
  Rat   249 MLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGI----LKMWKHE 309

  Fly   247 GPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
            |..|.||||.|..:|:.|..||.|:.|||.:
  Rat   310 GFFALYKGFWPNWLRLGPWNIIFFITYEQLK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 83/286 (29%)
Mito_carr 15..91 CDD:278578 29/87 (33%)
Mito_carr 93..187 CDD:278578 24/98 (24%)
Mito_carr 200..281 CDD:278578 30/88 (34%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 85/291 (29%)
Mito_carr 253..342 CDD:395101 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.