DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a27

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:295 Identity:81/295 - (27%)
Similarity:135/295 - (45%) Gaps:36/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDSSRRLPRWW-------FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGE----------- 49
            |:|.:.|.:.|       ..|..|.:|...|.|:||.|.:||.|.:|....:|:           
  Rat     6 EESLQPLTQRWPRTSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMESAPYRGM 70

  Fly    50 --ILKGIHERSGILGFYNGISASWFRQLTYTTTRFALYE------AGKDYVDTQKVSSKMALATF 106
              ...||.:..|.|..:.|::.:.:|.:.|:..|...||      .||...:...:...:.....
  Rat    71 MRTALGIVQEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMM 135

  Fly   107 AGIVGGIVGVPGDVVTVRLQNDVKLP-EEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAV 170
            ||::|..:..|.|:|.|::|.:.|.. |.|...::.|.....:|..|.|:..|:.|.:|.:.||.
  Rat   136 AGVIGQFLANPTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAA 200

  Fly   171 LLTIGTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSG 235
            |:.:|....||.||..|.:.|...:.:..|..:|..:|.:|.::..|.||||:..|| ||.:..|
  Rat   201 LVNMGDLTTYDTVKHYLVLNTALEDNIATHGLSSLCSGLVASILGTPADVIKSRIMN-QPRDKQG 264

  Fly   236 IGGAFLSTAK--------QGPLAFYKGFIPALIRV 262
            .|..:.|:..        :|.|:.||||:|:.:|:
  Rat   265 RGLLYKSSTDCVIQAVQGEGFLSLYKGFLPSWLRM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 77/276 (28%)
Mito_carr 15..91 CDD:278578 25/94 (27%)
Mito_carr 93..187 CDD:278578 26/94 (28%)
Mito_carr 200..281 CDD:278578 24/71 (34%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 24/98 (24%)
Mito_carr 122..218 CDD:278578 26/95 (27%)
Mito_carr 224..311 CDD:278578 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.