DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and SLC25A11

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens


Alignment Length:314 Identity:94/314 - (29%)
Similarity:147/314 - (46%) Gaps:44/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSRRLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQA----DRKTVGEILKGIHERSGILGFYN 65
            :|.:..::.|||:....|.....|:||:|.::|...:.    :.||....|..|.:..|:.|.|.
Human    18 TSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYT 82

  Fly    66 G----------------------------ISASWFRQLTYTTTRFALYE------AGKDYVDTQK 96
            |                            :||...||.||||||..:|.      .|.|......
Human    83 GYWGLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGF 147

  Fly    97 VSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRG 161
            : .|..:...||..|..||.|.:|..:|:..|.:||.::||.||:||:.|.||.:||||.:|:||
Human   148 L-LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRG 211

  Fly   162 TVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFM 226
            .:|.::|||::.....|:|.|.||.|..:....:.:..||..|.|:|.:....:.|:|:.||...
Human   212 CIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQ 276

  Fly   227 N-----AQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIRVSPNTIITFVLYEQ 275
            |     .:|...:|:...|.....:|..:.:|||.|...|:.|:|::||:..||
Human   277 NMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQ 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 90/302 (30%)
Mito_carr 15..91 CDD:278578 28/113 (25%)
Mito_carr 93..187 CDD:278578 37/93 (40%)
Mito_carr 200..281 CDD:278578 25/81 (31%)
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 17/60 (28%)
Mito_carr 144..241 CDD:278578 38/97 (39%)
Mito_carr 243..337 CDD:278578 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.