DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and ucp1

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:280 Identity:92/280 - (32%)
Similarity:142/280 - (50%) Gaps:23/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILG-------------FYNGI 67
            |..|.||...|.|:|..||:||.|.:   |.|....|||..: |:.|             .|||:
Zfish    21 GTAACIADLVTFPLDTAKVRLQIQGE---KAVTGAAKGIRYK-GVFGTISTMMRTEGPRSLYNGL 81

  Fly    68 SASWFRQLTYTTTRFALYEAGKDYVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQND 128
            .|...||:.:.:.|..||:..|.:....|.:..:|:...||...|.:.|    |.|||.||.|..
Zfish    82 VAGLQRQMAFASIRIGLYDNVKSFYTRGKDNPNVAVRILAGCTTGAMAVSMAQPTDVVKVRFQAQ 146

  Fly   129 VKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGA 193
            :.|....|| |........:|::.||:..|::||:|.::|..|:......:||.:|:.:......
Zfish   147 MNLQGVGRR-YNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRLL 210

  Fly   194 GEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEF-SGIGGAFLSTAKQGPLAFYKGFIP 257
            .:.:|.||.::..||.|..||..|:||:||.:||:.||:: |....|:....|:||.||||||:|
Zfish   211 SDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQYSSSTNCAWTMLTKEGPTAFYKGFVP 275

  Fly   258 ALIRVSPNTIITFVLYEQAR 277
            :.:|:....::.||.:||.:
Zfish   276 SFLRLGSWNVVMFVSFEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 90/276 (33%)
Mito_carr 15..91 CDD:278578 29/87 (33%)
Mito_carr 93..187 CDD:278578 29/97 (30%)
Mito_carr 200..281 CDD:278578 33/79 (42%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 29/92 (32%)
Mito_carr 111..208 CDD:395101 28/97 (29%)
Mito_carr 213..299 CDD:395101 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.