DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and UCP3

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 / 837973 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana


Alignment Length:297 Identity:88/297 - (29%)
Similarity:141/297 - (47%) Gaps:23/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRRLP---RWWFGGVCAAIAVTGTHPIDLIKVQLQ-----TQSQADRKTVGEILKGIHERSGILG 62
            :|..|   |.....:.|.:|.:.|.||||.|.::|     :.|.|.|.....::..|..:.|::|
plant     7 TREAPTGTRILLASLSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAFGVVSEIARKEGVIG 71

  Fly    63 FYNGISASWFRQLTYTTTRFALYEAGKDYVDTQKV--SSKMALAT------FAGIVGGIVGVPGD 119
            .|.|:|.:..|.|.||..|...||..|..:...:.  |..:.|||      |:|::..:|..|.|
plant    72 LYKGLSPAIIRHLFYTPIRIIGYENLKGLIVRSETNNSESLPLATKALVGGFSGVIAQVVASPAD 136

  Fly   120 VVTVRLQNDVKLPEE-KRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQV 183
            :|.||:|.|.:|..: .:..|....:...:|.:.|||..|::|.:|.:.||.|:.:|..|.||..
plant   137 LVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGELACYDHA 201

  Fly   184 KQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGE---FSGIGGAFLSTAK 245
            |..:.....|.:.:..|...|.::|..:..::.|.||:||..||  .||   :.......:.|.|
plant   202 KHFVIDKKIAEDNIFAHTLASIMSGLASTSLSCPADVVKTRMMN--QGENAVYRNSYDCLVKTVK 264

  Fly   246 -QGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFG 281
             :|..|.:|||.|...|:.|...:.:|.||:.|:..|
plant   265 FEGIRALWKGFFPTWARLGPWQFVFWVSYEKFRLLAG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 82/277 (30%)
Mito_carr 15..91 CDD:278578 26/80 (33%)
Mito_carr 93..187 CDD:278578 31/102 (30%)
Mito_carr 200..281 CDD:278578 26/84 (31%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:395101 28/94 (30%)
Mito_carr 110..209 CDD:395101 30/98 (31%)
Mito_carr 212..299 CDD:395101 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.