DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and UCP2

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 / 836014 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana


Alignment Length:285 Identity:92/285 - (32%)
Similarity:131/285 - (45%) Gaps:24/285 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VCAAIAV----TGTHPIDLIKVQLQTQSQAD----------RKTVGEILKGIHERSGILGFYNGI 67
            :|:|.|.    ..|.|:|..||:||.|.:..          |.::| .|..|....||.|.:.|:
plant    17 ICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIG-TLATIAREEGISGLWKGV 80

  Fly    68 SASWFRQLTYTTTRFALYE------AGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQ 126
            .|...||..|...|..|||      .|.|::....:..|:..|...|.:..||..|.|:|.||||
plant    81 IAGLHRQCIYGGLRIGLYEPVKTLLVGSDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQ 145

  Fly   127 NDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIAT 191
            ::.|||....|.|....|..|.|.|.||||:|:.|..|.::|..::.....|:|||:|:.:....
plant   146 SEGKLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIMKIP 210

  Fly   192 GAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAK-QGPLAFYKGF 255
            ...:.|..|......||..||.|..|:||:|:..|.  ...:......|:.|.| :|.:||||||
plant   211 FFRDSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMMG--DSTYRNTVDCFIKTMKTEGIMAFYKGF 273

  Fly   256 IPALIRVSPNTIITFVLYEQARMRF 280
            :|...|:.....|.|:..||.:..|
plant   274 LPNFTRLGTWNAIMFLTLEQVKKVF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 89/278 (32%)
Mito_carr 15..91 CDD:278578 28/93 (30%)
Mito_carr 93..187 CDD:278578 34/93 (37%)
Mito_carr 200..281 CDD:278578 28/82 (34%)
UCP2NP_568894.1 PTZ00169 11..296 CDD:240302 91/281 (32%)
Mito_carr 212..300 CDD:395101 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.