DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and AT5G19760

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:297 Identity:97/297 - (32%)
Similarity:141/297 - (47%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEDSSRRLPRWWF------GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSG 59
            |.|:....:..|..      ||....:|.....|||:|||::|....:.......:||    ..|
plant     1 MAEEKKAPISVWTTVKPFVNGGASGMLATCVIQPIDMIKVRIQLGQGSAASITTNMLK----NEG 61

  Fly    60 ILGFYNGISASWFRQLTYTTTR---FALYEA-------GKDYVDTQKVSSKMALATFAGIVGGIV 114
            :..||.|:||...||.||||.|   |.|..|       ||.....||....:.    ||.:|..|
plant    62 VGAFYKGLSAGLLRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKALCGLT----AGAIGACV 122

  Fly   115 GVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAA 179
            |.|.|:..:|:|.|..||..:||||.:.|..|.||..:|||.:|::|..|.|.||:.|.:|..|:
plant   123 GSPADLALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAMALNMGMLAS 187

  Fly   180 YDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQP---GEFSGIGG--A 239
            |||..:.::...|.|| :......|.::|..|...:.|.|.:||.....||   |::...|.  .
plant   188 YDQSAEYMRDNLGFGE-MSTVVGASAVSGFCAAACSLPFDFVKTQIQKMQPDAQGKYPYTGSLDC 251

  Fly   240 FLSTAKQ-GPLAFYKGFIPALIRVSPNTIITFVLYEQ 275
            .:.|.|: |||.||.||....:|::|:.::|::...|
plant   252 AMKTLKEGGPLKFYSGFPVYCVRIAPHVMMTWIFLNQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 93/275 (34%)
Mito_carr 15..91 CDD:278578 30/85 (35%)
Mito_carr 93..187 CDD:278578 37/93 (40%)
Mito_carr 200..281 CDD:278578 24/82 (29%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 25/77 (32%)
Mito_carr 101..199 CDD:395101 38/101 (38%)
Mito_carr 210..292 CDD:395101 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.