DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and DIC3

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:326 Identity:112/326 - (34%)
Similarity:159/326 - (48%) Gaps:68/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQ---------------------------------------- 39
            ||:.|.||...|||:|||||::|.|                                        
plant     9 GGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIGSIS 73

  Fly    40 ---------SQADRKTVGEILKGIH--ERSGILGFYNGISASWFRQLTYTTTRFALYEAGKDYVD 93
                     |.:.|..:.....|.|  :..|....::|:||:..||:.|:.||..:|    |::.
plant    74 LLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIY----DFLK 134

  Fly    94 ---TQKVSSKMALAT------FAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRI 149
               |.:::....|.|      .||.||.:||.|.||..||:|.|..||..:|||||.|.|.:.||
plant   135 RRWTDQLTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVVDAIDRI 199

  Fly   150 YKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGE--GVPLHFATSTIAGCIAV 212
            .::||||||:||:...|:||:::|....|.||.||::| :|.|.|.  |:..|.|.|..||.:|.
plant   200 ARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEIL-VAGGRGTPGGIGTHVAASFAAGIVAA 263

  Fly   213 VITQPLDVIKTTFMNAQPGEFSG-IGGAFLSTAKQGPLAFYKGFIPALIRVSPNTIITFVLYEQA 276
            |.:.|:||:||..|||....:.| :..|....|::||:|.|||.:|...|..|.|:|.|:..||.
plant   264 VASNPIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFLTLEQV 328

  Fly   277 R 277
            |
plant   329 R 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 109/322 (34%)
Mito_carr 15..91 CDD:278578 29/126 (23%)
Mito_carr 93..187 CDD:278578 44/102 (43%)
Mito_carr 200..281 CDD:278578 33/79 (42%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 25/123 (20%)
Mito_carr 143..238 CDD:395101 44/95 (46%)
Mito_carr 251..336 CDD:395101 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.