DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and DIC2

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:299 Identity:108/299 - (36%)
Similarity:156/299 - (52%) Gaps:36/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKT----------------------------VGEIL 51
            ||:.:.||...|||:|||||:||...:|...|                            ||.|.
plant     9 GGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVGPIS 73

  Fly    52 KGIH--ERSGILGFYNGISASWFRQLTYTTTRFALYEAGKD-YVDTQ----KVSSKMALATFAGI 109
            .||:  :..|....::|:||:..||..|:|||..|||..|: :.|.:    .:|.|:.....||.
plant    74 LGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTDPESGKLNLSRKIGAGLVAGG 138

  Fly   110 VGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTI 174
            :|..||.|.||..||:|.|.:||..:||||..|.|.:..:.|.|||:||:||:...::||:::|.
plant   139 IGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMIVTA 203

  Fly   175 GTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGA 239
            ...|:|||.|:.:.......:|:..|...|..||.:|.|.:.|:|||||..||.:.|.:.|....
plant   204 AQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVMNMKVGAYDGAWDC 268

  Fly   240 FLSTAK-QGPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
            .:.|.| :|.:|.||||:|.:.|..|.|::.||..||.|
plant   269 AVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 105/295 (36%)
Mito_carr 15..91 CDD:278578 35/106 (33%)
Mito_carr 93..187 CDD:278578 39/97 (40%)
Mito_carr 200..281 CDD:278578 33/79 (42%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 35/108 (32%)
Mito_carr 122..220 CDD:395101 38/97 (39%)
Mito_carr 225..312 CDD:395101 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.