DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and PUMP1

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:296 Identity:95/296 - (32%)
Similarity:136/296 - (45%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSRRLPRWWFGGVCAAIAV----TGTHPIDLIKVQLQTQSQADR------------KTVGEILKG 53
            |...||:.:   .|:|.|.    ..|.|:|..||:||.|..|..            .|||.|.: 
plant     7 SDLSLPKTF---ACSAFAACVGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAR- 67

  Fly    54 IHERSGILGFYNGISASWFRQLTYTTTRFALYE------AGKDYVDTQKVSSKMALATFAGIVGG 112
               ..|:...:.|:.....||..:...|..:||      .|||:|....:|.|:......|.:|.
plant    68 ---EEGLRSLWKGVVPGLHRQCLFGGLRIGMYEPVKNLYVGKDFVGDVPLSKKILAGLTTGALGI 129

  Fly   113 IVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTN 177
            :|..|.|:|.||||.:.||.....|.|....:....|.::|||.:|:.|..|.|:|..::.....
plant   130 MVANPTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAEL 194

  Fly   178 AAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLS 242
            |:|||||:.:....|..:.|..|..:...||..||.|..|:||:|:..| ...|.:.|....|:.
plant   195 ASYDQVKETILKIPGFTDNVVTHILSGLGAGFFAVCIGSPVDVVKSRMM-GDSGAYKGTIDCFVK 258

  Fly   243 TAK-QGPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
            |.| .||:||||||||...|:....:|.|:..|||:
plant   259 TLKSDGPMAFYKGFIPNFGRLGSWNVIMFLTLEQAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 89/282 (32%)
Mito_carr 15..91 CDD:278578 25/97 (26%)
Mito_carr 93..187 CDD:278578 31/93 (33%)
Mito_carr 200..281 CDD:278578 32/79 (41%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 26/105 (25%)
Mito_carr 110..206 CDD:395101 31/95 (33%)
Mito_carr 210..299 CDD:395101 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.