DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a27

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:292 Identity:81/292 - (27%)
Similarity:136/292 - (46%) Gaps:30/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AIAVTGTHPIDLIKVQLQTQSQADRKTVGE-------------ILKGIHERSGILGFYNGISASW 71
            :|.:| |.|:||.|.:||.|.:|....:|:             ...||.:..|.|..:.|::.:.
Mouse    45 SICLT-TFPLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAI 108

  Fly    72 FRQLTYTTTRFALYEAGKDYVDTQKVSSKMAL------ATFAGIVGGIVGVPGDVVTVRLQNDVK 130
            :|.:.|:..|...||..::.|..:.......|      ...||::|..:..|.|:|.|::|.:.|
Mouse   109 YRHVVYSGGRMVTYEHLREVVFGKSEDKHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGK 173

  Fly   131 LP-EEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAG 194
            .. |.|...::.|.....:|..|.|:..|:.|.:|.:.||.|:.:|....||.||..|.:.|...
Mouse   174 RRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLVLNTPLE 238

  Fly   195 EGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAK--------QGPLAF 251
            :.:..|..:|..:|.:|.::..|.||||:..|| ||.:..|.|..:.|:|.        :|.|:.
Mouse   239 DNISTHGLSSLCSGLVASILGTPADVIKSRIMN-QPRDKQGRGLLYKSSADCLIQAVQGEGFLSL 302

  Fly   252 YKGFIPALIRVSPNTIITFVLYEQARMRFGYL 283
            ||||:|:.:|:.....:.|:......:.|.||
Mouse   303 YKGFLPSWLRMVKMGEVLFLPLLLFSLYFSYL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 78/282 (28%)
Mito_carr 15..91 CDD:278578 22/83 (27%)
Mito_carr 93..187 CDD:278578 27/100 (27%)
Mito_carr 200..281 CDD:278578 26/88 (30%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 22/83 (27%)
Mito_carr 138..232 CDD:365909 27/93 (29%)
Mito_carr 240..>314 CDD:365909 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.