DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a11

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_077173.1 Gene:Slc25a11 / 67863 MGIID:1915113 Length:314 Species:Mus musculus


Alignment Length:286 Identity:93/286 - (32%)
Similarity:147/286 - (51%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSRRLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQA----DRKTVGEILKGIHERSGILGFYN 65
            :|.:..::.|||:....|.....|:||:|.::|...:.    :.||....|..|.:..|:.|.|.
Mouse    18 TSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYT 82

  Fly    66 GISASWFRQLTYTTTRFALYE------AGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVR 124
            |:||...||.||||||..:|.      .|.|......: .|..:...||..|..||.|.:|..:|
Mouse    83 GLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL-LKALIGMTAGATGAFVGTPAEVALIR 146

  Fly   125 LQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKI 189
            :..|.:||.::||.||:||:.|.||.:||||.:|:||.:|.::|||::.....|:|.|.||.|..
Mouse   147 MTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLD 211

  Fly   190 ATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMN-----AQPGEFSGIGGAFLSTAKQGPL 249
            :....:.:..||..|.|:|.:....:.|:|::||...|     .:|...:|:.........:|..
Mouse   212 SGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFF 276

  Fly   250 AFYKGFIPALIRVSPNTIITFVLYEQ 275
            :.:|||.|...|:.|:|::||:..||
Mouse   277 SLWKGFTPYYARLGPHTVLTFIFLEQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 89/274 (32%)
Mito_carr 15..91 CDD:278578 28/85 (33%)
Mito_carr 93..187 CDD:278578 37/93 (40%)
Mito_carr 200..281 CDD:278578 24/81 (30%)
Slc25a11NP_077173.1 Solcar 1 23..108 28/84 (33%)
Mito_carr 24..102 CDD:278578 27/77 (35%)
Mito_carr 116..213 CDD:278578 38/97 (39%)
Solcar 2 117..208 36/91 (40%)
Mito_carr 215..309 CDD:278578 24/88 (27%)
Solcar 3 217..306 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.