DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a30

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:262 Identity:69/262 - (26%)
Similarity:115/262 - (43%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI--------LKGIHERSGILGFYNGISAS 70
            :||:.:..|..||.||||.|.:||.|.|.:.....||        |..|....|:...|:||:.:
Mouse    11 YGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAPA 75

  Fly    71 WFRQLTYTTTRFALYEAGKDYVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQNDVKL 131
            ..||.:|.|.:...|::.|.....:.....:.:....||:.|::..    |.||:.:|:|     
Mouse    76 MLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQ----- 135

  Fly   132 PEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEG 196
             .:.......:.|....||::||...|::|......||.::.......||..|:.|.::...|:.
Mouse   136 -AQNSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDT 199

  Fly   197 VPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIR 261
            |..||.:|...|.:..:.:.|:||::|..||.:             ..:.|..|.|||.:..|::
Mouse   200 VATHFLSSFTCGLVGALASNPVDVVRTRMMNQR-------------ALRDGRCAGYKGTLDCLLQ 251

  Fly   262 VS 263
            ||
Mouse   252 VS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 69/261 (26%)
Mito_carr 15..91 CDD:278578 28/83 (34%)
Mito_carr 93..187 CDD:278578 20/97 (21%)
Mito_carr 200..281 CDD:278578 18/64 (28%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 28/84 (33%)
Mito_carr 105..191 CDD:365909 20/91 (22%)
Mito_carr 199..>259 CDD:365909 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.