DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and slc25a10

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:287 Identity:136/287 - (47%)
Similarity:177/287 - (61%) Gaps:9/287 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSRRLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISA 69
            :.||:.||:|||:.:..|...|||:|||||.||||.:...:..|..:..| ...|.|..|||:||
 Frog     2 AERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVI-RNDGFLALYNGLSA 65

  Fly    70 SWFRQLTYTTTRFALYEAGKDYVDTQKVS-----SKMALATFAGIVGGIVGVPGDVVTVRLQNDV 129
            |.|||:||:.||||:||..:|.:.....:     .|:.|....|..||.:|.|.|:|.||:||||
 Frog    66 SLFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDV 130

  Fly   130 KLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATG-A 193
            |||...||||.|..||:||:.:|||...||.|...|.||..|:|:|..|.|||.||:: :.|| .
 Frog   131 KLPAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLV-LNTGFL 194

  Fly   194 GEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPA 258
            .:.:..||..|:|||..|..:.|||||:||..|||: ||:.|:....|.|||.||||||||.:||
 Frog   195 SDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPA 258

  Fly   259 LIRVSPNTIITFVLYEQARMRFGYLPP 285
            .||:.|:|::|||..||.|..||...|
 Frog   259 GIRLIPHTVLTFVFLEQLRKYFGVKVP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 125/265 (47%)
Mito_carr 15..91 CDD:278578 36/75 (48%)
Mito_carr 93..187 CDD:278578 45/98 (46%)
Mito_carr 200..281 CDD:278578 44/80 (55%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 37/77 (48%)
Mito_carr 96..190 CDD:365909 45/94 (48%)
Mito_carr 197..281 CDD:365909 44/84 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1953
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.