DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Ucp2

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_062227.2 Gene:Ucp2 / 54315 RGDID:3932 Length:309 Species:Rattus norvegicus


Alignment Length:278 Identity:87/278 - (31%)
Similarity:138/278 - (49%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GVCAAIAVTGTHPIDLIKVQLQTQSQAD-----------RKTVGEILKGIHERSGILGFYNGISA 69
            |..|.||...|.|:|..||:||.|.::.           |..:|.||..: ...|....|||:.|
  Rat    21 GTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYRGVLGTILTMV-RTEGPRSLYNGLVA 84

  Fly    70 SWFRQLTYTTTRFALYEAGKDYV----DTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVK 130
            ...||:::.:.|..||::.|.:.    :...:.|::...:..|.:...|..|.|||.||.|...:
  Rat    85 GLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR 149

  Fly   131 LPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGE 195
            ....:|  |:...:....|.:|||:..|::||.|.|:|..::.......||.:|..|..|....:
  Rat   150 AGGGRR--YQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCTELVTYDLIKDTLLKANLMTD 212

  Fly   196 GVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLS-TAKQGPLAFYKGFIPAL 259
            .:|.||.::..||....||..|:||:||.:||:..|::...|...|: ..|:||.||||||:|:.
  Rat   213 DLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSF 277

  Fly   260 IRVSPNTIITFVLYEQAR 277
            :|:....::.||.|||.:
  Rat   278 LRLGSWNVVMFVTYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 85/274 (31%)
Mito_carr 15..91 CDD:278578 27/85 (32%)
Mito_carr 93..187 CDD:278578 25/93 (27%)
Mito_carr 200..281 CDD:278578 32/79 (41%)
Ucp2NP_062227.2 Mito_carr 10..111 CDD:395101 27/90 (30%)
Solcar 1 11..106 27/85 (32%)
Mito_carr 112..206 CDD:395101 26/95 (27%)
Solcar 2 114..203 25/90 (28%)
Solcar 3 212..297 33/84 (39%)
Mito_carr 217..299 CDD:395101 32/79 (41%)
Purine nucleotide binding. /evidence=ECO:0000250 276..298 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.