DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and slc25a27

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001011241.1 Gene:slc25a27 / 496683 XenbaseID:XB-GENE-1005902 Length:319 Species:Xenopus tropicalis


Alignment Length:301 Identity:89/301 - (29%)
Similarity:140/301 - (46%) Gaps:29/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI------------LKGIHERSGI 60
            |..::......|::|...|.|:||.|.:||.|.:|..|..||:            ..||.:..|:
 Frog    16 RTSKFILSACAASVAELVTFPLDLTKTRLQIQGEAALKRHGEVGSAVPYRGMVRTATGIVQEEGL 80

  Fly    61 LGFYNGISASWFRQLTYTTTRFALYEAGKDYV------DTQKVSSKMALATFAGIVGGIVGVPGD 119
            |..:.|.:.:.:|.:.|:..|...||..:|.|      ||..:...:.....||.:|.....|.|
 Frog    81 LKLWQGATPAVYRHIVYSGVRMVAYEHIRDSVLGKGDGDTFPLWKSVVGGMTAGAIGQFFASPTD 145

  Fly   120 VVTVRLQNDVKLP-EEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQV 183
            :|.|::|.:.|.. |.|....:.|:.....|..:.|:..|:.|.||.|.||.|:.:|....||.|
 Frog   146 LVKVQMQMEGKRRLEGKPPRVRGVYHAFVTIVSKGGIRGLWAGWVPNVQRAALVNMGDLTTYDMV 210

  Fly   184 KQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAK--- 245
            |..|...|...:....|..:|..:|.:|..:..|.|||||..|| ||.:..|.|..:.|:..   
 Frog   211 KHFLLRNTPIKDNSLCHTISSICSGVVAATLGTPADVIKTRIMN-QPRDKHGRGLLYKSSTDCLI 274

  Fly   246 -----QGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFG 281
                 :|.::.||||:|..:|::|.:::.::.|||.| |.|
 Frog   275 QAIRGEGFMSLYKGFMPTWMRMAPWSLVFWLTYEQIR-RLG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 83/286 (29%)
Mito_carr 15..91 CDD:278578 24/87 (28%)
Mito_carr 93..187 CDD:278578 29/94 (31%)
Mito_carr 200..281 CDD:278578 30/88 (34%)
slc25a27NP_001011241.1 Mito_carr 18..114 CDD:365909 26/95 (27%)
Mito_carr 122..216 CDD:365909 28/93 (30%)
Mito_carr 223..313 CDD:365909 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.