DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and rangrf

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_002941865.3 Gene:rangrf / 496602 XenbaseID:XB-GENE-5760490 Length:238 Species:Xenopus tropicalis


Alignment Length:117 Identity:27/117 - (23%)
Similarity:42/117 - (35%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 EGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML-KIATGAGEGVPLHFATSTI---AGCIAVV 213
            ||.|.:. ...|.....:.||..|||......|:: |....|...|.:|.|...:   :..:.|.
 Frog   128 EGQSEVL-SVEPLPLAQLTLTACTNAWVLTGHQLVAKFNEEARNAVTIHMALFRLPQHSTDMLVT 191

  Fly   214 ITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIRVSPN 265
            ...|..:        .|...|.:|||.|:......||.:...:..|...:|:
 Frog   192 FNDPAAI--------NPSSSSAVGGASLAPLSPWTLADFNRLLCTLQLHNPS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 27/117 (23%)
Mito_carr 15..91 CDD:278578
Mito_carr 93..187 CDD:278578 10/33 (30%)
Mito_carr 200..281 CDD:278578 14/69 (20%)
rangrfXP_002941865.3 Mog1 58..238 CDD:238137 27/117 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.