DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and mfrn

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:293 Identity:76/293 - (25%)
Similarity:117/293 - (39%) Gaps:36/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEDSSRRLPRWWFGGVCAAIAVTGT------HPIDLIKVQLQTQSQADRK-TVGEILKGIHERS 58
            |..|....||....|....|.|:.|.      :|:|.:|.::|:.|...:. .:...|:.:..|.
  Fly     1 MNIDDYESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITRE 65

  Fly    59 GILGFYNGISASWFRQLTYTTTRFALYEAGKDYVDTQKVSSKMAL-----ATFAGIVGGIVGVPG 118
            |:|....|.||.........:..||.||..|:.  |.|.:|...|     ...|.::...:..|.
  Fly    66 GLLRPIRGASAVVLGAGPAHSLYFAAYEMTKEL--TAKFTSVRNLNYVISGAVATLIHDAISSPT 128

  Fly   119 DVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFR--GTVPAVSRAVLLTIGTNAAYD 181
            ||:..|:|       .....|..|...:..|||.||..:.:|  ||...::........|...:.
  Fly   129 DVIKQRMQ-------MYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFF 186

  Fly   182 QVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQ 246
            |.|..|:    .....|:|.|....||..|..:|.|||||| |.:|.|.   :|:....:..:::
  Fly   187 QNKMNLE----RKYNPPVHMAAGAAAGACAAAVTTPLDVIK-TLLNTQE---TGLTRGMIEASRK 243

  Fly   247 -----GPLAFYKGFIPALIRVSPNTIITFVLYE 274
                 |||.|::|....::...|.|.|.:..||
  Fly   244 IYHMAGPLGFFRGTTARVLYSMPATAICWSTYE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 72/279 (26%)
Mito_carr 15..91 CDD:278578 21/82 (26%)
Mito_carr 93..187 CDD:278578 23/100 (23%)
Mito_carr 200..281 CDD:278578 26/80 (33%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 21/84 (25%)
PTZ00168 17..280 CDD:185494 71/277 (26%)
Mito_carr 107..190 CDD:278578 19/89 (21%)
Mito_carr <215..282 CDD:278578 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.