DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and CG5805

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:292 Identity:62/292 - (21%)
Similarity:107/292 - (36%) Gaps:73/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PIDLIKVQLQTQSQADRKTVGEILKG-------IHERSGILGFYNG-------ISASWFRQLTYT 78
            |:.:||.|||.|.::|      :.||       |:...|:.|.|.|       |.:..|...||.
  Fly    59 PLTVIKTQLQVQHKSD------VYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTYE 117

  Fly    79 TTRFALYEAGKDYVDTQKVSSKMALA--TFAGIVGGIVGVPGDVVTVRLQ--------------N 127
            ..|..|.:.|..:       ...|||  ..|.:||..:.||.||::....              |
  Fly   118 GVRHVLNDLGAGH-------RMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDIN 175

  Fly   128 DVKLPEEKRRNYKHVFDGLFR-IYKEEGVSSLFRGTVPAVSRAVLLTIGTNAA---------YDQ 182
            .:.:.....|:..|:...:.| |.:.:|....:||..     |.|:....|:|         .|:
  Fly   176 PLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYT-----ASLMAYVPNSAMWWAFYHLYQDE 235

  Fly   183 VKQMLKIATGAGEGVPLHFATSTIAGCI----AVVITQPLDVIKTTFMNAQPGEFSGIGGAFLST 243
            :.::..:...       |.....:||.:    ..::|.|||:::.   ..|......:..||...
  Fly   236 LFRICPVWVS-------HLFIQCVAGSLGGFTTTILTNPLDIVRA---RLQVHRLDSMSVAFREL 290

  Fly   244 AKQGPL-AFYKGFIPALIRVSPNTIITFVLYE 274
            .::..| .|:||....|::.:..:....:.||
  Fly   291 WQEEKLNCFFKGLSARLVQSAAFSFSIILGYE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 62/292 (21%)
Mito_carr 15..91 CDD:278578 22/76 (29%)
Mito_carr 93..187 CDD:278578 23/119 (19%)
Mito_carr 200..281 CDD:278578 17/80 (21%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 21/71 (30%)
Mito_carr 132..238 CDD:395101 23/110 (21%)
Mito_carr 245..327 CDD:395101 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.