DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and GC1

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:293 Identity:71/293 - (24%)
Similarity:118/293 - (40%) Gaps:53/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQS---QADR--KTVGEILKGIHERSGILGFYNGIS 68
            ||:...||:...|.||...|:||:|.:||.|.   ..:|  .::.:..:..::..|..|.|.|..
  Fly    22 LPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSG 86

  Fly    69 ASWFRQLTYTTTRFALYEAGKDYVD---TQK-----VSSKMALATFAGIVGGIVGVPGDVVTVRL 125
            .:    :...|...|:.....||..   |.|     ::|:|.....||....||..|.:::.:::
  Fly    87 VN----ILLITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQM 147

  Fly   126 QNDVKLPEEKRRNYKHV-----FDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQ 185
            |:..::....:...|.|     .....::.|::|:..|::|            ||.....|....
  Fly   148 QDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKG------------IGATGLRDVTFS 200

  Fly   186 ML---KIAT----------GAGEGV-PLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPG----E 232
            ::   ..||          |:||.| ...|.....||..|.:...|.||:||.....:..    |
  Fly   201 IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKE 265

  Fly   233 FSGIGGAFLSTAK-QGPLAFYKGFIPALIRVSP 264
            |.||......|.| :||.||:||.:..:|.::|
  Fly   266 FKGISDCITKTLKHEGPTAFFKGGLCRMIVIAP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 69/287 (24%)
Mito_carr 15..91 CDD:278578 19/80 (24%)
Mito_carr 93..187 CDD:278578 19/106 (18%)
Mito_carr 200..281 CDD:278578 23/70 (33%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 19/80 (24%)
Mito_carr 115..213 CDD:278578 19/109 (17%)
Mito_carr 226..307 CDD:278578 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.