DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and CG16736

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:68/258 - (26%)
Similarity:121/258 - (46%) Gaps:19/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 THPIDLIKVQLQTQ-SQADRKTVGEILKGIHERSGILGFYNGISASWFRQLTYTTTRFALY---E 86
            :||::|::|.:|.. ....|.::..:.: :..|.|:.|||.||.|:..|...:|.:.:.|:   :
  Fly    17 SHPMELVRVNMQANVIHHSRLSINHMFR-LMARHGLPGFYYGIVAACLRCTVHTMSTYTLFYNLQ 80

  Fly    87 AGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYK 151
            ..|..:..|..::.|.|. ..|..||::..|...:.|..|.|:.....:||||::.:.||..:|.
  Fly    81 DNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRGLKCMYA 144

  Fly   152 EEGVSSLFRG----TVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAV 212
            :.|.:.||.|    ::.:.:.|||.|    ...|:|..::.......|.......|..:.|.|..
  Fly   145 KGGFTYLFTGWKINSISSTAVAVLYT----PISDKVHTVISWFHRLDEPWLSDLITMALTGSIIT 205

  Fly   213 VITQPLDVIKTTFMNAQPGEFSGIGGAFL---STAKQGPLAFYKGFIPALIRVSPNTII-TFV 271
            ||..|:|.:.|..:| :...:......:|   ...|.|...|:.|:.|||:.:.|:|:: |||
  Fly   206 VIMTPVDALATLTLN-ESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 68/258 (26%)
Mito_carr 15..91 CDD:278578 18/68 (26%)
Mito_carr 93..187 CDD:278578 27/97 (28%)
Mito_carr 200..281 CDD:278578 22/76 (29%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/64 (27%)
Mito_carr 187..277 CDD:278578 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.