DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Dic4

DIOPT Version :10

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_649054.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:64 Identity:13/64 - (20%)
Similarity:27/64 - (42%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 VVLSHCGIDVDRSIAANVGPLVDIIVGGHSHSFLYTGDHPTIPMNPVSEYPTVVSQPNGHRVLI 281
            :||.:||...:::::..:   |:...|...|.|.:..|      ..:...|.|.:...||..::
  Fly   154 MVLYNCGHPKNKTLSPEI---VNTQTGAFLHRFQWLED------EEIGSIPFVWNFLEGHNRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 Mito_carr 15..91 CDD:395101
Mito_carr 93..187 CDD:395101
Mito_carr 200..281 CDD:395101 13/62 (21%)
Dic4NP_649054.1 Mito_carr 26..100 CDD:395101
Mito_carr 104..201 CDD:395101 11/55 (20%)
Mito_carr 211..292 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.