DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and slc25a30

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001165746.1 Gene:slc25a30 / 394840 XenbaseID:XB-GENE-995074 Length:291 Species:Xenopus tropicalis


Alignment Length:284 Identity:83/284 - (29%)
Similarity:132/284 - (46%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI--------LKGIHERSGILGFYNGISAS 70
            :||:.:..|..||.||||.|.:||.|.||:.....||        :..|.:..|:...|:||:.:
 Frog    11 YGGLASITAECGTFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIWKEEGVKALYSGIAPA 75

  Fly    71 WFRQLTYTTTRFALYEAGKD-YVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQNDVK 130
            ..||.:|.|.:...|::.|. :||..: ...:.:..|.|::.|:|..    |.||:.:|:|....
 Frog    76 MLRQASYGTIKIGTYQSLKRLFVDCPE-DETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQGS 139

  Fly   131 LPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGE 195
            |.:      ..:......||::||...|::|......||.::.......||..|:.|.::...|:
 Frog   140 LIQ------GGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGD 198

  Fly   196 GVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQP------GEFSGIGGAFLSTAK-QGPLAFYK 253
            .|..||..|...|....:.:.|:||::|..||.:.      ..:.|.....|.|.| :|..|.||
 Frog   199 TVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSIRNVSNSSYKGTLDCLLQTWKNEGFFALYK 263

  Fly   254 GFIPALIRVSPNTIITFVLYEQAR 277
            ||.|..:|:.|..||.|:.|||.:
 Frog   264 GFWPNWLRLGPWNIIFFITYEQLK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 81/279 (29%)
Mito_carr 15..91 CDD:278578 28/84 (33%)
Mito_carr 93..187 CDD:278578 22/97 (23%)
Mito_carr 200..281 CDD:278578 29/85 (34%)
slc25a30NP_001165746.1 Solcar 1 7..96 28/84 (33%)
PTZ00169 9..289 CDD:240302 83/284 (29%)
Solcar 2 104..189 21/90 (23%)
Solcar 3 198..289 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.