DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Bmcp

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:311 Identity:96/311 - (30%)
Similarity:141/311 - (45%) Gaps:44/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEDSSRRLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI-LKG-------IHER 57
            |||....|  .:.:|||.:..|..||.|||..|.:||.|.|...::..:: .:|       |...
  Fly     1 MGEVKDWR--PFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISRE 63

  Fly    58 SGILGFYNGISASWFRQLTYTTTRFALYEAGKDYVD----------TQKVSSKMALATFAGIVGG 112
            .|:...|:||..:..||.||.|.:|..|...|...:          :::|.|.:..|..||.:..
  Fly    64 EGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISS 128

  Fly   113 IVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTN 177
            .:..|.||:.||:|      ...:..:|.:......|||.|||..|:||..|...|||::.....
  Fly   129 AIANPTDVLKVRMQ------VHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVEL 187

  Fly   178 AAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMN--------------- 227
            ..||..|  |::....|:.|..||.:|.||...:.:.:.|:|||:|..||               
  Fly   188 PVYDFCK--LQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAA 250

  Fly   228 AQPGEFSG-IGGAFLSTAKQGPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
            |.|..:|| :..|..:...:|..|.||||||..:|:.|..||.|:.|||.:
  Fly   251 ATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 90/293 (31%)
Mito_carr 15..91 CDD:278578 28/83 (34%)
Mito_carr 93..187 CDD:278578 28/103 (27%)
Mito_carr 200..281 CDD:278578 33/94 (35%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 29/91 (32%)
Mito_carr <132..199 CDD:278578 24/74 (32%)
Mito_carr 204..303 CDD:278578 34/98 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.