DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and CG7514

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:276 Identity:85/276 - (30%)
Similarity:144/276 - (52%) Gaps:10/276 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQ-TQSQADRKTVGEILKGIHERSGILGFYNGISASWFRQLTYT 78
            ||:...:......|:||:|.::| :.:..:.|:..:.|..:.:..|||..|||:||...||.|||
  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYT 83

  Fly    79 TTRFALYEAGKDYVDTQ-----KVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRN 138
            |.|...|:...|....|     .|.:.|.:...||..|.:.|.|.:|..:|:.:|.:||..:|||
  Fly    84 TARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRN 148

  Fly   139 YKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFAT 203
            |..|.:...||.|:|||.:|::|.:|.|.||:::.:...|:|.|:|...   :....|:.||.|.
  Fly   149 YTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF---SEYFSGLSLHIAA 210

  Fly   204 STIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAK-QGPLAFYKGFIPALIRVSPNTI 267
            :.::|.:..:.:.|||:.||.....:..|:.|.....:..:| :|..:.:|||.|.|.|:.|:|:
  Fly   211 AMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTV 275

  Fly   268 ITFVLYEQARMRFGYL 283
            ..|:..||....:.::
  Fly   276 FAFIFLEQLTKAYKHI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 83/266 (31%)
Mito_carr 15..91 CDD:278578 25/76 (33%)
Mito_carr 93..187 CDD:278578 34/98 (35%)
Mito_carr 200..281 CDD:278578 23/81 (28%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 85/270 (31%)
Mito_carr 19..90 CDD:278578 24/70 (34%)
Mito_carr 104..201 CDD:278578 33/99 (33%)
Mito_carr 207..284 CDD:278578 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.