DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and PMP34

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:295 Identity:69/295 - (23%)
Similarity:128/295 - (43%) Gaps:32/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNG----ISASWFRQL 75
            |.....||::..:|:|.::.:||.:...|.::..:::|.|....|....|.|    :.:......
  Fly    22 GAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCISNF 86

  Fly    76 TYTTTRFALYEAGKDYVDTQKVSSK-MALATFAGIVGGIVGVPGDVVTVRL--QNDVKLPEEKRR 137
            .|..|..||.........:|..:.| :.|.:.|||:..:...|..||..||  :|.....:|..:
  Fly    87 VYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNK 151

  Fly   138 NYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAA-----YDQVKQMLKIATGAGEGV 197
            :||::.:||..:.::||::.|:.||:|:      |.:.:|.|     |:.:|:.:...||...|.
  Fly   152 HYKNLLEGLKYVAEKEGIAGLWSGTIPS------LMLVSNPALQFMMYEMLKRNIMRFTGGEMGS 210

  Fly   198 PLHFATSTIAGCIAVVITQPLDVIKT------TFMNAQPGEFSGIGGAFLSTAK--------QGP 248
            ...|....||...|.|:|.||.:::|      ...:::|...:|......||.:        ||.
  Fly   211 LSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGI 275

  Fly   249 LAFYKGFIPALIRVSPNTIITFVLYEQARMRFGYL 283
            ...::|....:::......:.|:.||:.....|.|
  Fly   276 RGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGML 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 66/285 (23%)
Mito_carr 15..91 CDD:278578 17/79 (22%)
Mito_carr 93..187 CDD:278578 28/101 (28%)
Mito_carr 200..281 CDD:278578 19/94 (20%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 16/73 (22%)
Mito_carr 105..202 CDD:278578 28/102 (27%)
Mito_carr 214..303 CDD:278578 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.