DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Tpc2

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:320 Identity:73/320 - (22%)
Similarity:123/320 - (38%) Gaps:71/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQ-------ADRKTVGEILKGIHERSGILGFYNGISASWF 72
            ||:..|...|.|.|:|::|::.|.|.:       :..:.|....|.::...|:.|.:.|.::...
  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQV 80

  Fly    73 RQLTYTTTRFALYEAGK------DYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKL 131
            ..::|...:|..||..:      ||...:...........||.:|.:...|.|||..::   |..
  Fly    81 LSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQM---VAA 142

  Fly   132 PEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTN-AAYDQVKQMLKIATGAGE 195
            ....||:..:.|.||.::||.||...|.|| :|.....|...:|.| ..|..:...:.:|....:
  Fly   143 DPSSRRSQMNTFTGLRKVYKMEGWMGLSRG-LPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQ 206

  Fly   196 GVPLH----FATSTIAGCIAVVITQPLDVIK-----------------------------TTFMN 227
            ...:|    |....::|.:|.:|..|.|::|                             |||..
  Fly   207 RQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTFRE 271

  Fly   228 AQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFGYLPPDK 287
                  .||||            ||||.:|.|::....:.:.|.:|:..:..  |:.|.|
  Fly   272 ------EGIGG------------FYKGMLPTLLKAGLMSAVYFSIYDMFKRH--YIAPMK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 70/306 (23%)
Mito_carr 15..91 CDD:278578 19/88 (22%)
Mito_carr 93..187 CDD:278578 25/94 (27%)
Mito_carr 200..281 CDD:278578 23/113 (20%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 67/302 (22%)
Mito_carr 23..99 CDD:278578 16/75 (21%)
Mito_carr 108..194 CDD:278578 25/89 (28%)
Mito_carr 216..307 CDD:278578 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.