DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Shawn

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:350 Identity:78/350 - (22%)
Similarity:127/350 - (36%) Gaps:82/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEDSSRRLPRWWFGGVCAAIAVTGTH--PIDLIKVQLQTQSQA--DRK---------------- 45
            |.:...|..|.......|....||...  |:|:||.:||.|.||  ..|                
  Fly    30 MTDPRFRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCG 94

  Fly    46 -----------------TVGEILKGIHERSGILGFYNGISASWFRQLTYTTTRFALYEAGK---- 89
                             |:...:| |....||...::|:|.:....|..|...|..||..|    
  Fly    95 PDTPNPAAAKPAPRFSGTIDAFIK-ISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFT 158

  Fly    90 --DYVDTQKVSS---------KMALATFAGIVGGIVGV----PGDVVTVRLQNDVKLPEEKRRNY 139
              .|..|::..:         ...:...||:.|.|:.|    |.:::..::|:       :|..:
  Fly   159 DIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQS-------QRMTH 216

  Fly   140 KHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGV-PLHFAT 203
            ..:|..:.::.:.:||..|:||..|.:.|.|..    :..|....:.||.:.|..|.. ...||.
  Fly   217 AEMFGTIRQVVQSQGVLGLWRGLPPTILRDVPF----SGIYWTCYEYLKSSFGVVEPTFSFSFAA 277

  Fly   204 STIAGCIAVVITQPLDVIKT----------TFMNAQPGEFS--GIGGAFLSTAKQGPL-AFYKGF 255
            ..|:|.:|..||.|.||:||          .|.:..|.:.:  .:.....|..:.|.: |.:.|.
  Fly   278 GAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGL 342

  Fly   256 IPALIRVSPNTIITFVLYEQARMRF 280
            .|.|.:|:|...|....:|..:..|
  Fly   343 GPRLFKVAPACAIMISSFEYGKSFF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 73/329 (22%)
Mito_carr 15..91 CDD:278578 26/118 (22%)
Mito_carr 93..187 CDD:278578 19/106 (18%)
Mito_carr 200..281 CDD:278578 24/93 (26%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 27/120 (23%)
Mito_carr 178..265 CDD:278578 20/97 (21%)
Mito_carr 268..371 CDD:278578 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.