DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and CG18324

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:127/290 - (43%) Gaps:35/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQ-ADRKT-------VGEILKGIHERSGILGFYNGISASW 71
            ||..|..||..|:|||::|.::|.|.: |.|.|       :.:.:..|....|:|....|::.:.
  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPAL 73

  Fly    72 FRQLTYTTTRFALY----EAGKDYVDTQKVSSKMALATFAGIVGGIVGV--PGDVVTVRLQNDVK 130
            ..|....:.|.::|    |.|  |:.....|.......|.|.:||..|.  ......::.|...:
  Fly    74 CYQFVLNSVRLSVYSNALELG--YLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQ 136

  Fly   131 LPEEKRRNYKH----VFDGLFRIYKEEGVSSLFRGTVPAVSRAVL---LTIGTNAAYDQVKQMLK 188
            ..:.....::|    :.|.|..||:..|:|..:|..:|:::|.::   :.|||   :.:.|.:||
  Fly   137 AVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGT---FPKAKSLLK 198

  Fly   189 IATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGE-------FSGIGGAFLSTAK- 245
            ........|.|.|.....:|.:..|...|.||: ||.|..||.:       :.|:...|....: 
  Fly   199 DKGWITHPVLLSFCAGLSSGTLVAVANSPFDVL-TTRMYNQPVDEKGRGLMYKGLVDCFTKIWRT 262

  Fly   246 QGPLAFYKGFIPALIRVSPNTIITFVLYEQ 275
            :|....||||.|...|.:|:|.:|||.:|:
  Fly   263 EGIHGMYKGFWPIYFRSAPHTTLTFVFFEK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 75/288 (26%)
Mito_carr 15..91 CDD:278578 24/87 (28%)
Mito_carr 93..187 CDD:278578 21/102 (21%)
Mito_carr 200..281 CDD:278578 26/84 (31%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 21/77 (27%)
PTZ00169 5..293 CDD:240302 76/290 (26%)
Mito_carr 101..201 CDD:278578 23/102 (23%)
Mito_carr 204..296 CDD:278578 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.