DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and colt

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:300 Identity:83/300 - (27%)
Similarity:132/300 - (44%) Gaps:45/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGE--ILKGIHE-------RSGILGFYNGISA 69
            |||:|   .|...||:|.|||:|||.   .|...||  :.:|..:       ..|:.|.|.|:||
  Fly    24 FGGIC---NVLSGHPLDTIKVRLQTM---PRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSA 82

  Fly    70 SWFRQLTYTTTRFALYEAGKDYVDTQKVSSK-----------MALATFAGIVGGIVGVPGDVVTV 123
                .||.....||:..||  |...:::..:           ....:|:|:...::..||:.:.|
  Fly    83 ----PLTGVAPIFAMCFAG--YALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKV 141

  Fly   124 RLQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLK 188
            .||  .:..:...|.|..:.|...::|||.|:.|:|:|:...:.|    .:..|..|..|.:.|:
  Fly   142 LLQ--TQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLR----DLPANGLYFLVYEALQ 200

  Fly   189 -IATGAGEGVPLHFATSTIAGCIA----VVITQPLDVIKTTFMNAQPGEFS-GIGGAFLS-TAKQ 246
             :|....|...:..|::..||.:|    .::..|.||:|:...:|..|.:. ||...|.. ..|.
  Fly   201 DVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKD 265

  Fly   247 GPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFGYLPPD 286
            ||||.|:|..|.::|..|.....|...|.|...|..:.|:
  Fly   266 GPLALYRGVTPIMLRAFPANAACFFGIELANKFFNIVAPN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 78/286 (27%)
Mito_carr 15..91 CDD:278578 29/84 (35%)
Mito_carr 93..187 CDD:278578 21/104 (20%)
Mito_carr 200..281 CDD:278578 26/86 (30%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 31/94 (33%)
Mito_carr 112..202 CDD:395101 22/95 (23%)
Mito_carr 210..299 CDD:395101 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.