DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Ucp4A

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:297 Identity:80/297 - (26%)
Similarity:139/297 - (46%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGE----------ILKGIHERSGILGFYNGISASW 71
            |.|:||...|:|:||.|.:||.|.:....:.|:          ...||....|.|..:.|::.:.
  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPAL 113

  Fly    72 FRQLTYTTTRFALYE-AGKDYVDTQKVSSKMALATFAGIVGGIV----GVPGDVVTVRLQNDVKL 131
            :|.:.|:..|...|: ..|::......:..:..:...|:..|.|    ..|.|:|.|::|     
  Fly   114 YRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQ----- 173

  Fly   132 PEEKRR---------NYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML 187
            .|.:||         :..|.|.   :|.:..|:..|::|::|.|.||.|:.:|....||.:|.::
  Fly   174 MEGRRRLMGEPPRVHSAGHAFR---QIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLI 235

  Fly   188 KIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAF--------LSTA 244
            .......:...:|...|..||.:|.::..|.||:||..|| ||.:.:|.|..:        .:.:
  Fly   236 MNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMN-QPTDENGRGLLYRGSVDCLRQTVS 299

  Fly   245 KQGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFG 281
            |:|.:|.||||:|..||::|.::..::.:||.|...|
  Fly   300 KEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 76/289 (26%)
Mito_carr 15..91 CDD:278578 23/84 (27%)
Mito_carr 93..187 CDD:278578 26/106 (25%)
Mito_carr 200..281 CDD:278578 30/88 (34%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 79/294 (27%)
Mito_carr 39..138 CDD:278578 23/88 (26%)
Mito_carr 142..239 CDD:278578 26/104 (25%)
Mito_carr 248..336 CDD:278578 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.