DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Ant2

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:118/295 - (40%) Gaps:41/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKG-------IHERSGILGFYNGISASWF 72
            |||.||||.|...||:.:|:.||.|..:.:....:..||       |.:..|...|:.|..|:..
  Fly    25 GGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVI 89

  Fly    73 RQLTYTTTRFALYEAGKDY----VDTQKVSSKMALATFAGIV--GGIVGV-------PGDVVTVR 124
            |........||..:..|..    ||    ..|.....|||.:  ||..|.       |.|....|
  Fly    90 RYFPTQALNFAFKDVYKSVFLGGVD----KHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTR 150

  Fly   125 LQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKI 189
            |..||  .:...|.:..:.|.|.::.|.:|...|:||.:.:|...|:........||..:..|. 
  Fly   151 LAADV--GKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLP- 212

  Fly   190 ATGAGEGVPLH--FATSTIAGCIAVVITQPLDVIKTTFMNAQPG------EFSGIGGAFLSTAKQ 246
               ..:..|.:  :|.:.:...:|.:.:.|.|.::...| .|.|      .:......:|..|||
  Fly   213 ---NPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMM-MQSGLKKSEMVYKNTAHCWLVIAKQ 273

  Fly   247 -GPLAFYKGFIPALIRVSPNTIITFVLYEQARMRF 280
             |..||:||.:..:||.:...:: ..||::.:..|
  Fly   274 EGIGAFFKGALSNIIRGTGGALV-LALYDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 74/288 (26%)
Mito_carr 15..91 CDD:278578 25/82 (30%)
Mito_carr 93..187 CDD:278578 26/102 (25%)
Mito_carr 200..281 CDD:278578 21/90 (23%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 74/291 (25%)
Mito_carr 17..111 CDD:278578 25/85 (29%)
Mito_carr 119..215 CDD:278578 25/101 (25%)
Mito_carr 218..307 CDD:278578 21/90 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.