DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and sesB

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:292 Identity:68/292 - (23%)
Similarity:121/292 - (41%) Gaps:41/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKG-------IHERSGILGFYNGISASWF 72
            ||:.||::.|...||:.:|:.||.|..:.:.:..:..||       |.:..|...|:.|..|:..
  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVI 94

  Fly    73 RQLTYTTTRFALYEAGKDY----VDTQKVSSKMALATFAGIV--GGIVGV-------PGDVVTVR 124
            |........||..:..|..    ||    .:......|||.:  ||..|.       |.|....|
  Fly    95 RYFPTQALNFAFKDKYKQVFLGGVD----KNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR 155

  Fly   125 LQNDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKI 189
            |..|.  .:..:|.:..:.:.|.:|:|.:|:..|:||...:|...::........||..:.||. 
  Fly   156 LAADT--GKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLP- 217

  Fly   190 ATGAGEGVPLH--FATSTIAGCIAVVITQPLDVIKTTFMNAQPGE------FSGIGGAFLSTAKQ 246
               ..:..|::  :|.:.:...:|.:::.|.|.::...| .|.|.      :......:.:.|||
  Fly   218 ---DPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMM-MQSGRKATEVIYKNTLHCWATIAKQ 278

  Fly   247 -GPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
             |..||:||....::|.:....: .|||::.:
  Fly   279 EGTGAFFKGAFSNILRGTGGAFV-LVLYDEIK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 68/288 (24%)
Mito_carr 15..91 CDD:278578 22/82 (27%)
Mito_carr 93..187 CDD:278578 23/102 (23%)
Mito_carr 200..281 CDD:278578 19/87 (22%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 22/85 (26%)
PTZ00169 23..312 CDD:240302 68/292 (23%)
Mito_carr 124..220 CDD:278578 24/101 (24%)
Mito_carr 223..312 CDD:278578 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.