DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and CG1628

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:293 Identity:69/293 - (23%)
Similarity:120/293 - (40%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGIL-GFYNGISASWFRQLTYT 78
            |.:..|..|..:.|:|.:||:|||..:|.|..: :.....:.:.|:| |.|.|...:.|..:...
  Fly   176 GSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGML-DCFLSTYRKDGVLRGLYAGSVPAVFANVAEN 239

  Fly    79 TTRFALYEAGKDYV----------DTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQ------- 126
            :..||.|...:.:|          |...|.:..| .:.|.....:...|.:::..:||       
  Fly   240 SVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACA-GSLAACFSTLTLCPTELIKCKLQALREMKN 303

  Fly   127 -------NDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVK 184
                   .|::.|....|          .|::.||:...:||......|.:........:|:..:
  Fly   304 FVEPAHPQDIRTPWTLTR----------YIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTR 358

  Fly   185 QMLKIATGAGEGV-PLHFATSTIAGCIAVVI----TQPLDVIKTTFMNAQPGEFSGIGGAFLSTA 244
            ::|:....:.:.: ||.   :.|||.|..|.    |.|.||||:........|.....||.: ..
  Fly   359 ELLRRDDQSKDDIGPLR---TMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADI-VR 419

  Fly   245 KQGPLAFYKGFIPALIRVSPNTIITFVLYEQAR 277
            ::|.||.|:|.:|:::|..|.|...||:||..:
  Fly   420 REGVLALYRGLLPSVLRTIPATATLFVVYEYTK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 68/289 (24%)
Mito_carr 15..91 CDD:278578 21/76 (28%)
Mito_carr 93..187 CDD:278578 17/107 (16%)
Mito_carr 200..281 CDD:278578 27/82 (33%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 69/293 (24%)
Mito_carr 170..252 CDD:278578 21/76 (28%)
Mito_carr 263..364 CDD:278578 18/111 (16%)
Mito_carr 369..455 CDD:278578 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.