DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a10

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:284 Identity:129/284 - (45%)
Similarity:180/284 - (63%) Gaps:9/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWF 72
            |..||:|||:.:..|...|||:||:||.||||.:...:..|..|: :....|.|..|||:|||..
Mouse     5 RASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQ-VVRTDGFLALYNGLSASLC 68

  Fly    73 RQLTYTTTRFALYEAGKDYV--DTQ---KVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLP 132
            ||:||:.||||:||..:||:  |:|   ...:|:.|...:|:.||.||.|.|:|.||:|||:|||
Mouse    69 RQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLP 133

  Fly   133 EEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATG-AGEG 196
            ..:||||.|..|||:|:.:||.:..||.|...|.||..|:|:|..:.|||.||:: ::|| ..:.
Mouse   134 PSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLV-LSTGYLSDN 197

  Fly   197 VPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIR 261
            :..||.:|.|||..|..:.|||||:||..||:: ||:.|:....:.|||.||.||:||..||.||
Mouse   198 IFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAMETAKLGPQAFFKGLFPAGIR 261

  Fly   262 VSPNTIITFVLYEQARMRFGYLPP 285
            :.|:|::||:..||.|..||...|
Mouse   262 LIPHTVLTFMFLEQLRKHFGIKVP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 119/265 (45%)
Mito_carr 15..91 CDD:278578 34/75 (45%)
Mito_carr 93..187 CDD:278578 45/96 (47%)
Mito_carr 200..281 CDD:278578 39/80 (49%)
Slc25a10NP_038798.2 Solcar 1 7..87 37/80 (46%)
Mito_carr 12..92 CDD:278578 36/80 (45%)
Mito_carr 94..189 CDD:278578 43/95 (45%)
Solcar 2 100..187 42/86 (49%)
Solcar 3 196..279 39/83 (47%)
Mito_carr 197..283 CDD:278578 41/86 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 1 1.010 - - QHG51917
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104245
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1953
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.670

Return to query results.
Submit another query.